Cart
sales@molnova.com
Home - Products - Others - Other Targets - ACTH 4-11

ACTH 4-11

CAS No. 67224-41-3

ACTH 4-11( Adrenocorticotropic Hormone (4-11), human )

Catalog No. M29944 CAS No. 67224-41-3

ACTH (4-11) is a peptide fragment of adrenocorticotropic hormone, a peptide hormone found in the brain that is involved in the biological stress response.

ACTH (4-11) is a peptide fragment of adrenocorticotropic hormone, a peptide hormone found in the brain that is involved in the biological stress response.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
5MG 81 Get Quote
10MG 133 Get Quote
25MG 266 Get Quote
100MG Get Quote Get Quote
200MG Get Quote Get Quote
500MG Get Quote Get Quote
Group Booking Get Quotation Bulk Inquiry Add to Cart

Biological Information

  • Product Name
    ACTH 4-11
  • Note
    Research use only, not for human use.
  • Brief Description
    ACTH (4-11) is a peptide fragment of adrenocorticotropic hormone, a peptide hormone found in the brain that is involved in the biological stress response.
  • Description
    ACTH (4-11) is a peptide fragment of adrenocorticotropic hormone, a peptide hormone found in the brain that is involved in the biological stress response.(In Vitro):α-melanocyte stimulating hormone (MSH) induces the differentiation of mouse epidermal melanocytes in vivo and in vitro. Adrenocorticotropic hormone (ACTH) possesses the same amino acid sequence as MSH does. α-MSH induces the differentiation of mouse epidermal melanocytes in vivo and in vitro. ACTH (4-11) loses almost all activity for the binding to melanocortin receptor 1 (MC1R).
  • In Vitro
    α-melanocyte stimulating hormone (MSH) induces the differentiation of mouse epidermal melanocytes in vivo and in vitro. Adrenocorticotropic hormone (ACTH) possesses the same amino acid sequence as MSH does. α-MSH induces the differentiation of mouse epidermal melanocytes in vivo and in vitro. ACTH (4-11) loses almost all activity for the binding to melanocortin receptor 1 (MC1R).
  • In Vivo
  • Synonyms
    Adrenocorticotropic Hormone (4-11), human
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
  • Research Area
  • Indication

Chemical Information

  • CAS Number
    67224-41-3
  • Formula Weight
    1090.26
  • Molecular Formula
    C50H71N15O11S
  • Purity
    >98% (HPLC)
  • Solubility
  • SMILES
  • Chemical Name
    Sequence:Met-Glu-His-Phe-Arg-Trp-Gly-Lys

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

Hirobe T, et al. ACTH(4-12) is the minimal message sequence required to induce the differentiation of mouse epidermal melanocytes in serum-free primary culture. J Exp Zool. 2000 May 1;286(6):632-40.
Calculator

Molecular Weight Calculator

Dilution Calculator

Molarity Calculator

molnova catalog
related products

  • Egg Laying Hormone, ...

    Egg-laying hormone (ELH) is a neuropeptide synthesized by the bag cell neurons, Egg-laying hormone (ELH) induces egg laying and its correlated behavior in Aplysia californica. Egg-laying hormone (ELH) has been purified to homogeneity and Egg-laying hormone (ELH)'s primary structure has been determined. Egg-laying hormone (ELH) have 36 amino acid residues with a Mr of 4385 and a calculated isoelectric point of 9.7. Egg Laying Hormone of Aplysia induces a voltage-dependent slow inward current carried by Na+ in an identified motoneuron.

  • Exendin-4 peptide de...

    FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.

  • 8-Hydroxybergapten

    8-Hydroxybergapten may have anti-wrinkle activity.

Sign In Join Free